PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108642.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Trihelix
Protein Properties Length: 690aa    MW: 75828.2 Da    PI: 5.9014
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108642.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.49.3e-2959142186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW++qe+  L+++r++m+ ++r+++ k+plWeevs+k++e g++rs+k+Ckek+en+ k++k++keg++++   + +t+++fdql+
  XP_010108642.1  59 RWPRQETISLLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKYHKRTKEGRSGK--ADGKTYRFFDQLQ 142
                     8********************************************************************96..66678******98 PP

2trihelix107.21.1e-33484569187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev+aLi++r++++ +++++  k+plWee+s++m++ g++rs+k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+a
  XP_010108642.1 484 RWPKVEVHALIKLRTDLDAKYQDNGPKGPLWEEISEAMKRVGYNRSAKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLDA 569
                     8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.009756118IPR001005SANT/Myb domain
PfamPF138372.0E-1858144No hitNo description
PROSITE profilePS500906.73758116IPR017877Myb-like domain
CDDcd122032.83E-2458123No hitNo description
SMARTSM007170.0012481543IPR001005SANT/Myb domain
PfamPF138373.6E-23483570No hitNo description
PROSITE profilePS500907.294483541IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.8E-4483540IPR009057Homeodomain-like
CDDcd122033.22E-28483548No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MLGDSSSTAL GSSSGDASAA AAEAPPTETA HDGGGSGGGG EDERIRGEEL GDRSFGGNRW  60
PRQETISLLK IRSDMDVAFR DASVKGPLWE EVSRKLAELG YHRSAKKCKE KFENVYKYHK  120
RTKEGRSGKA DGKTYRFFDQ LQALENQPSP YSLPPPPPPP QPAAAAATTT QPKAQAPAMQ  180
AATTTTIATA TPAMSVSISP LHNSTVPSVS NTTATNISSQ GTMNLTFPSP PFQAAPTNPT  240
INFPTPPPVQ GTAPTPTPPP PFHRISADLM SEYSTSSSTS SDEELEEGGG RRKRKRKWKD  300
FFERLMKEVI HRQEELQKRF LEAIEKREHD RMVREEAWRM QEMTRINRER EILAQERSMA  360
AAKDAAVMAF LQKISDQQNI PNISIPNPTP TPTPAPPPPP PSSGQNNTTS ITPVISIQTL  420
QPSAPAPAVL IPAPTPVAPV SVSAPMSQLA TIDVPKPDNN NNNNNALATT TPMTAGMGGA  480
SSSRWPKVEV HALIKLRTDL DAKYQDNGPK GPLWEEISEA MKRVGYNRSA KRCKEKWENI  540
NKYFKKVKES NKRRPEDSKT CPYFHQLDAL YREKSMKFDP TISSTTTTND NIMSTATAHH  600
HHQHQLHQFG KSEINVVPLM VQPEQQWPPP PQQPGSSNQH ESAESDQPMD RNEEEDEEDD  660
DEDEDEDDEG GDNYELVANK PNSVSNVSAE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290295RRKRKR
2290296RRKRKRK
3291296RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108642.10.0Trihelix transcription factor GT-2
TrEMBLW9S0630.0W9S063_9R
STRINGGLYMA20G30640.11e-178(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-51Trihelix family protein